| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB818202.1 | 5prime_partial | 173 | 1-522(+) |
Amino Acid sequence : | |||
| GRVDMCTYAAWDVFLVLILLLTEITPKSIAVHHATEVVRFVVARLEDVVEEIVGEIYDENDSKEEIQRKIGYVVIRAEGIYEVDANTAIDQLSRDLHIKMPELDNRGSSWHGLHFEGAIK PNISRVDADDQLEWAKWLIRHGLAKPNHISLYGWSYRGYLSSAFFFIRVMVML* | |||
Physicochemical properties | |||
| Number of amino acids: | 173 | ||
| Molecular weight: | 19,886.565 | ||
| Theoretical pI: | 5.324 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37930 37930 | ||
| Instability index: | 34.029 | ||
| aromaticity | 0.104 | ||
| GRAVY | 0.005 | ||
Secondary Structure Fraction | |||
| Helix | 0.387 | ||
| turn | 0.168 | ||
| sheet | 0.272 | ||