Acc_NO	ORF type	length	start-end position (strand +/-)
>CB818218.1	internal	126	3-380(+)
Amino Acid sequence :
GGIMASPHGNEKPLRKISDAFKDVAAAVAVSSRGGADVEIASFSQACSLLSPLFGCLGIAFKFAEMDYVAKVNDLSHASKSLTTLQSLLDRDIQSNTVRKPGSHTRNLLRVKRGLDMVKV LFEQII
Physicochemical properties
Number of amino acids:		126
Molecular weight:		13,545.509
Theoretical pI:		9.302
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1615
Instability index:		35.206
aromaticity		0.056
GRAVY		0.048
Secondary Structure Fraction
Helix		0.302
turn		0.246
sheet		0.270