Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB818224.1 | internal | 150 | 2-451(+) |
Amino Acid sequence : | |||
VGYLQSCRKNAHDCHFTSDMEIDQCEASIYISNNQGEVYSLSIHHPRLKWIQDFNLFNERLTVTQGNNGMLYVTVPAIYVVFALDAFSGDILWQKSIGPLSSASYKPVVDSNGWISVGSL DGFLYSFSPTGTLKKFTRSSSTDSVIQVGP | |||
Physicochemical properties | |||
Number of amino acids: | 150 | ||
Molecular weight: | 16,638.509 | ||
Theoretical pI: | 5.707 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27055 | ||
Instability index: | 27.384 | ||
aromaticity | 0.120 | ||
GRAVY | -0.094 | ||
Secondary Structure Fraction | |||
Helix | 0.347 | ||
turn | 0.300 | ||
sheet | 0.160 |