| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB818224.1 | internal | 150 | 2-451(+) |
Amino Acid sequence : | |||
| VGYLQSCRKNAHDCHFTSDMEIDQCEASIYISNNQGEVYSLSIHHPRLKWIQDFNLFNERLTVTQGNNGMLYVTVPAIYVVFALDAFSGDILWQKSIGPLSSASYKPVVDSNGWISVGSL DGFLYSFSPTGTLKKFTRSSSTDSVIQVGP | |||
Physicochemical properties | |||
| Number of amino acids: | 150 | ||
| Molecular weight: | 16,638.509 | ||
| Theoretical pI: | 5.707 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27055 | ||
| Instability index: | 27.384 | ||
| aromaticity | 0.120 | ||
| GRAVY | -0.094 | ||
Secondary Structure Fraction | |||
| Helix | 0.347 | ||
| turn | 0.300 | ||
| sheet | 0.160 | ||