| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB818239.1 | 3prime_partial | 145 | 87-521(+) |
Amino Acid sequence : | |||
| MLSTGKVVLKSSDKETFEIDRSVACLSQTIKYMLEDVSAENAIPLPNITGSVLAKVIEYCKMHVVVDSNPNMSEDDRGTAEEVEKFDQEFVKVNQNTLFDLILAANYLDIKGLLALTCRT AADSIKNLSVEDVRKIFNIENDFTA | |||
Physicochemical properties | |||
| Number of amino acids: | 145 | ||
| Molecular weight: | 15,364.502 | ||
| Theoretical pI: | 6.762 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5750 | ||
| Instability index: | 66.670 | ||
| aromaticity | 0.075 | ||
| GRAVY | 0.001 | ||
Secondary Structure Fraction | |||
| Helix | 0.376 | ||
| turn | 0.211 | ||
| sheet | 0.188 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB818239.1 | 5prime_partial | 133 | 521-120(-) |
Amino Acid sequence : | |||
| CSKIILNVENLPNIFDGQIFNGISSSSASQCQKSLDIQIVRSQDEIEQCVLVNLHKFLVKFFNLFSSTSIILRHIGITIHHHMHLAIFDDLRKNRTSNIGEWDSVLRRDILEHVLDGLRQ ARHRPVDLECFFV* | |||
Physicochemical properties | |||
| Number of amino acids: | 133 | ||
| Molecular weight: | 15,364.502 | ||
| Theoretical pI: | 6.762 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5750 | ||
| Instability index: | 66.670 | ||
| aromaticity | 0.075 | ||
| GRAVY | 0.001 | ||
Secondary Structure Fraction | |||
| Helix | 0.376 | ||
| turn | 0.211 | ||
| sheet | 0.188 | ||