| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB818244.1 | complete | 165 | 56-553(+) |
Amino Acid sequence : | |||
| MACSASPLLGNKSAAHGGVGVCFRGGKSSPSPMKAFCVPSYRRNPNLASVRAQQSGNQGDSVPVTTNHSQRNNGGGAVERRPKRTALDISPFGLIDSLSPMRTMRQMLDTMDRIFDDAMV SLPTMGEGRAPWDVMEDEHEIRMRFDMPGLSREDVKVSLRTAAFL* | |||
Physicochemical properties | |||
| Number of amino acids: | 165 | ||
| Molecular weight: | 17,955.297 | ||
| Theoretical pI: | 9.294 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 57.564 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.448 | ||
Secondary Structure Fraction | |||
| Helix | 0.206 | ||
| turn | 0.309 | ||
| sheet | 0.248 | ||