Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB818244.1 | complete | 165 | 56-553(+) |
Amino Acid sequence : | |||
MACSASPLLGNKSAAHGGVGVCFRGGKSSPSPMKAFCVPSYRRNPNLASVRAQQSGNQGDSVPVTTNHSQRNNGGGAVERRPKRTALDISPFGLIDSLSPMRTMRQMLDTMDRIFDDAMV SLPTMGEGRAPWDVMEDEHEIRMRFDMPGLSREDVKVSLRTAAFL* | |||
Physicochemical properties | |||
Number of amino acids: | 165 | ||
Molecular weight: | 17,955.297 | ||
Theoretical pI: | 9.294 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 57.564 | ||
aromaticity | 0.048 | ||
GRAVY | -0.448 | ||
Secondary Structure Fraction | |||
Helix | 0.206 | ||
turn | 0.309 | ||
sheet | 0.248 |