Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB818267.1 | complete | 137 | 89-502(+) |
Amino Acid sequence : | |||
MANSASGMAVHDECKLKFQELKAKRSYRFITFKIEGQQAVVDKIGGHGENYENFTRSLPTDECRYAVFDFDFTTNENCQKSKIFFIAWAPDTSKVRNKMLYVSSKDRFKRELDGIQVELQ ATDPSEMSFDIIKARAL* | |||
Physicochemical properties | |||
Number of amino acids: | 137 | ||
Molecular weight: | 15,780.743 | ||
Theoretical pI: | 7.682 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
Instability index: | 38.161 | ||
aromaticity | 0.117 | ||
GRAVY | -0.537 | ||
Secondary Structure Fraction | |||
Helix | 0.277 | ||
turn | 0.182 | ||
sheet | 0.234 |