| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB818272.1 | internal | 132 | 1-396(+) |
Amino Acid sequence : | |||
| GVFHHLKQHYPDHKFIGEETTAACGLSELTDAPTWIVDPLDGTTNFVHGFPFVCVSIGLTIGKIPTVGVVYNPIMDELFTGIRGKGAFLNGNPIKVSSKDELVKALLVTEAGTKRDKETL DALTNRIKALLY | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 14,366.381 | ||
| Theoretical pI: | 6.202 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 11.800 | ||
| aromaticity | 0.083 | ||
| GRAVY | 0.040 | ||
Secondary Structure Fraction | |||
| Helix | 0.341 | ||
| turn | 0.220 | ||
| sheet | 0.227 | ||