Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB818281.1 | internal | 178 | 1-534(+) |
Amino Acid sequence : | |||
GDVSRLIKSTAGGDGQRGPITRDFLGGSFGIESKELDLDLHVPVGWEKRLDLKSGNVYIQRCNNPIIPTTTTTTSTFGLRNNIQTTTSSLVHEFGFPCSQTQPQPKPKPKQPPTSSHTLA LFDDPTNLDLKLVSPANTATSTTSCYQSMCTLDKVKSALDRAWRDPPPSTASSRSLSG | |||
Physicochemical properties | |||
Number of amino acids: | 178 | ||
Molecular weight: | 19,219.325 | ||
Theoretical pI: | 8.743 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
Instability index: | 44.944 | ||
aromaticity | 0.056 | ||
GRAVY | -0.552 | ||
Secondary Structure Fraction | |||
Helix | 0.230 | ||
turn | 0.320 | ||
sheet | 0.163 |