Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB818290.1 | 5prime_partial | 127 | 2-385(+) |
Amino Acid sequence : | |||
ANTSVEDVSVENAIPLPNVTGKILAKVIEYCKMHVETTQAEDRTVTEKELQNFDADFVKVDQNTLFDLISAANYLNIKGLLDLTCQTAADMMKGKSVEEIRSTFNIKNDYTPEEEEEVRR ENQWAFE* | |||
Physicochemical properties | |||
Number of amino acids: | 127 | ||
Molecular weight: | 14,449.974 | ||
Theoretical pI: | 4.464 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 45.569 | ||
aromaticity | 0.071 | ||
GRAVY | -0.506 | ||
Secondary Structure Fraction | |||
Helix | 0.283 | ||
turn | 0.165 | ||
sheet | 0.299 |