| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB818290.1 | 5prime_partial | 127 | 2-385(+) |
Amino Acid sequence : | |||
| ANTSVEDVSVENAIPLPNVTGKILAKVIEYCKMHVETTQAEDRTVTEKELQNFDADFVKVDQNTLFDLISAANYLNIKGLLDLTCQTAADMMKGKSVEEIRSTFNIKNDYTPEEEEEVRR ENQWAFE* | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 14,449.974 | ||
| Theoretical pI: | 4.464 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 45.569 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.506 | ||
Secondary Structure Fraction | |||
| Helix | 0.283 | ||
| turn | 0.165 | ||
| sheet | 0.299 | ||