| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB818292.1 | internal | 163 | 2-490(+) |
Amino Acid sequence : | |||
| DLDLGVTPYVDEDYGDAVKSLLMNFESARVLTIDPFIIQAIWTATNSRRLSSYLAVTHLILGTSFHRYEFVGISCLLRSVSSLKCLQFDIVSPIDHYEVFDEGSESPFNPDKFWDGLTNP PRDHSPVMSIQQAVFNGIQGTLQEVIINRFQGTVNEMSFLRFI | |||
Physicochemical properties | |||
| Number of amino acids: | 163 | ||
| Molecular weight: | 18,454.700 | ||
| Theoretical pI: | 4.693 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18575 | ||
| Instability index: | 46.017 | ||
| aromaticity | 0.117 | ||
| GRAVY | 0.035 | ||
Secondary Structure Fraction | |||
| Helix | 0.374 | ||
| turn | 0.245 | ||
| sheet | 0.202 | ||