| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB818307.1 | internal | 144 | 3-434(+) |
Amino Acid sequence : | |||
| GHASALNTCGKDGGQVMDNGISNCIGHPASTVKELEAPQSVEGGALWDIFRREDVPKLQEYLKKHFREFRHIHCQPVPMVVHPIHDQTFYLTREHLQKLKHEYGIEPWTFVQKVGDAVFI PAGCPHQVRNLKSCIKVAMDFVSP | |||
Physicochemical properties | |||
| Number of amino acids: | 144 | ||
| Molecular weight: | 16,266.491 | ||
| Theoretical pI: | 7.280 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
| Instability index: | 44.207 | ||
| aromaticity | 0.083 | ||
| GRAVY | -0.371 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.215 | ||
| sheet | 0.201 | ||