Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB818313.1 | internal | 170 | 2-511(+) |
Amino Acid sequence : | |||
ALGPLTNIAMAIKRDSSFAKKTKRLVILGGAFFALGNVNPAAEANIYGDPEAADVVFTSGANITVAGINITTQVKLSDDDLLDLRQSNGRHAQLISDMCKFYREWHMKSDGLPGIFLHDP VSFVAVVRPDLFTYKKGVVRVETQGICAGHTLMDQGLKRWNTSNPWTGYS | |||
Physicochemical properties | |||
Number of amino acids: | 170 | ||
Molecular weight: | 18,556.019 | ||
Theoretical pI: | 8.596 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22585 | ||
Instability index: | 34.909 | ||
aromaticity | 0.088 | ||
GRAVY | -0.078 | ||
Secondary Structure Fraction | |||
Helix | 0.312 | ||
turn | 0.241 | ||
sheet | 0.229 |