Acc_NO	ORF type	length	start-end position (strand +/-)
>CB818344.1	internal	163	3-491(+)
Amino Acid sequence :
EAWAAPGSVFDLFLESFRIGNNTQHLLRHLLLVSFDDKAHERCLEVRKHCYRLDTQQRPMNLTKEAFYMSENYLEIVWRKIDFLHSVLTLGFNFVFTDCDIMWLQDPFPRLAGDSNFQVA CDMYIGNPTSMNNLPNTGFLYVRSDKHTILFYKIWYMSRYTYK
Physicochemical properties
Number of amino acids:		163
Molecular weight:		19,429.072
Theoretical pI:		6.659
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		35410 35660
Instability index:		42.252
aromaticity		0.160
GRAVY		-0.246
Secondary Structure Fraction
Helix		0.368
turn		0.190
sheet		0.239