Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CK445294.1 | internal | 200 | 3-602(+) |
Amino Acid sequence : | |||
HLHHLAGEMAAVTTQASAAVLRPCSSRSRFLTGTSGKLHRAFPAKTVPSPTLINSFKVEAKKGEWLPGLASPAYLDGSLPGDNGFDPLGLAEDPENLKWYIQAELVNSRWAMLGVAGMLL PEVFTKIGIINVPQWYDAGKAEYFASSSTLFVIEFILFTTSRSPVAGHQGPRLCQPGPIFKNYSLPPKNVGTWDILNPLT | |||
Physicochemical properties | |||
Number of amino acids: | 200 | ||
Molecular weight: | 16,280.642 | ||
Theoretical pI: | 4.558 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29115 | ||
Instability index: | 70.302 | ||
aromaticity | 0.066 | ||
GRAVY | -0.501 | ||
Secondary Structure Fraction | |||
Helix | 0.258 | ||
turn | 0.272 | ||
sheet | 0.318 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CK445294.1 | complete | 151 | 506-51(-) |
Amino Acid sequence : | |||
MSCHRGSRRSEQDELDDEEGGGGGEVLGLAGVVPLWHIDDAYLGEDFWEQHSGHAQHRPPAVHKLRLDIPLEVLRVLRQAEWVEAVVAREAAVEVGGGGEAGEPLSLLGFNFEGVDQGGG WDGFCRECSVELAGGAGEEPRSRRAWPEDSG* | |||
Physicochemical properties | |||
Number of amino acids: | 151 | ||
Molecular weight: | 16,280.642 | ||
Theoretical pI: | 4.558 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29115 | ||
Instability index: | 70.302 | ||
aromaticity | 0.066 | ||
GRAVY | -0.501 | ||
Secondary Structure Fraction | |||
Helix | 0.258 | ||
turn | 0.272 | ||
sheet | 0.318 |