| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CK445296.1 | 5prime_partial | 163 | 3-494(+) |
Amino Acid sequence : | |||
| GCSASVREGAPPPPPPPPANMGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKS AIVQVDAAPFKQWYLQHYGVEIGRKKKPPPPLLLRRNRLGSRR* | |||
Physicochemical properties | |||
| Number of amino acids: | 163 | ||
| Molecular weight: | 15,109.504 | ||
| Theoretical pI: | 11.640 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 80.458 | ||
| aromaticity | 0.007 | ||
| GRAVY | -0.143 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.226 | ||
| sheet | 0.299 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CK445296.1 | 3prime_partial | 137 | 413-3(-) |
Amino Acid sequence : | |||
| MLQIPLLERRSVHLNNSALHKSLRTNKLIVGSIVHDIQYTRLASHSLASPGVVPGVETECPPLDVAAADADPPNRLVARQLRVRRLPPELVLSLLPPCLLLAAGGAALVHGVTRDTHVCR RRRRRRRRSLSHTRAAT | |||
Physicochemical properties | |||
| Number of amino acids: | 137 | ||
| Molecular weight: | 15,109.504 | ||
| Theoretical pI: | 11.640 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 80.458 | ||
| aromaticity | 0.007 | ||
| GRAVY | -0.143 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.226 | ||
| sheet | 0.299 | ||