Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CK445296.1 | 5prime_partial | 163 | 3-494(+) |
Amino Acid sequence : | |||
GCSASVREGAPPPPPPPPANMGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKS AIVQVDAAPFKQWYLQHYGVEIGRKKKPPPPLLLRRNRLGSRR* | |||
Physicochemical properties | |||
Number of amino acids: | 163 | ||
Molecular weight: | 15,109.504 | ||
Theoretical pI: | 11.640 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 80.458 | ||
aromaticity | 0.007 | ||
GRAVY | -0.143 | ||
Secondary Structure Fraction | |||
Helix | 0.292 | ||
turn | 0.226 | ||
sheet | 0.299 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CK445296.1 | 3prime_partial | 137 | 413-3(-) |
Amino Acid sequence : | |||
MLQIPLLERRSVHLNNSALHKSLRTNKLIVGSIVHDIQYTRLASHSLASPGVVPGVETECPPLDVAAADADPPNRLVARQLRVRRLPPELVLSLLPPCLLLAAGGAALVHGVTRDTHVCR RRRRRRRRSLSHTRAAT | |||
Physicochemical properties | |||
Number of amino acids: | 137 | ||
Molecular weight: | 15,109.504 | ||
Theoretical pI: | 11.640 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 80.458 | ||
aromaticity | 0.007 | ||
GRAVY | -0.143 | ||
Secondary Structure Fraction | |||
Helix | 0.292 | ||
turn | 0.226 | ||
sheet | 0.299 |