Acc_NO	ORF type	length	start-end position (strand +/-)
>CK445299.1	internal	136	2-409(+)
Amino Acid sequence :
SIRFSSHQEERNPSIFQMARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVG LFEDTNLCAIHAKRVT
Physicochemical properties
Number of amino acids:		136
Molecular weight:		15,444.671
Theoretical pI:		10.850
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		4470 4470
Instability index:		39.451
aromaticity		0.066
GRAVY		-0.663
Secondary Structure Fraction
Helix		0.243
turn		0.162
sheet		0.272