Acc_NO	ORF type	length	start-end position (strand +/-)
>CK445303.1	internal	119	2-358(+)
Amino Acid sequence :
DAWVFSMSSGFLTATTPVAGSGYVGLKPDPSAKLFQVKLSVGWQARTISNGSRVHCMKTWSPINNKKFEALSYLPPLSDESIAKEVDYMLAKGWVPCLEFDEVGNVHRTHSQIPGYYDG
Physicochemical properties
Number of amino acids:		119
Molecular weight:		13,113.754
Theoretical pI:		7.009
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		29450 29575
Instability index:		32.676
aromaticity		0.118
GRAVY		-0.214
Secondary Structure Fraction
Helix		0.311
turn		0.294
sheet		0.210