Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CV130357.1 | 5prime_partial | 137 | 1-414(+) |
Amino Acid sequence : | |||
TGNQNQTSFYPSVPHEISVLVELILGHLRYLLTDAPPQPNSPPDNVFRPDRPAEAGLWSKKRGDAPLPIHGISKITLKVVVFHFRLSAPTYPTPLKSFHKVGLESSSTGSSFPADSAKPV PLAVVSLDSRQGQWESR* | |||
Physicochemical properties | |||
Number of amino acids: | 137 | ||
Molecular weight: | 14,976.820 | ||
Theoretical pI: | 9.394 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
Instability index: | 53.425 | ||
aromaticity | 0.080 | ||
GRAVY | -0.338 | ||
Secondary Structure Fraction | |||
Helix | 0.299 | ||
turn | 0.336 | ||
sheet | 0.197 |