Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CV130358.1 | 5prime_partial | 128 | 1-387(+) |
Amino Acid sequence : | |||
TGNQNQTSFYPSVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRPDRPAEAGLWSKKRGDAPLPIHGISKITLKVVVFHFRLSAPTYPTPLKSFHKVGLESSSTGSSFPADSAKPV PLAGGFAG* | |||
Physicochemical properties | |||
Number of amino acids: | 128 | ||
Molecular weight: | 13,765.534 | ||
Theoretical pI: | 9.396 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 49.919 | ||
aromaticity | 0.086 | ||
GRAVY | -0.203 | ||
Secondary Structure Fraction | |||
Helix | 0.305 | ||
turn | 0.352 | ||
sheet | 0.195 |