Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CV130364.1 | internal | 135 | 1-405(+) |
Amino Acid sequence : | |||
TGNQNQTSFYPSVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRPDRPAEAGLWSKKRGDAPLPIHGISKITLKVVVFHFRLSAPTLSYTSQVISQSRTKSQAQQGLLSPLIPPAP FLGCGFVDSRRDSGN | |||
Physicochemical properties | |||
Number of amino acids: | 135 | ||
Molecular weight: | 14,780.684 | ||
Theoretical pI: | 9.574 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 59.859 | ||
aromaticity | 0.074 | ||
GRAVY | -0.264 | ||
Secondary Structure Fraction | |||
Helix | 0.311 | ||
turn | 0.333 | ||
sheet | 0.178 |