Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CV130367.1 | 5prime_partial | 146 | 1-441(+) |
Amino Acid sequence : | |||
TGNQNQTSFYPSVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRPDRPAEAGLWSKKRGDAPLPIHGISKITLKVVVFHFRLSAPTYPTPLKSFHKVGLESSSTGSSFPADSAKPV PLAVVSLDSRQGQWESSLIHSCRVTN* | |||
Physicochemical properties | |||
Number of amino acids: | 146 | ||
Molecular weight: | 15,959.962 | ||
Theoretical pI: | 9.205 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
Instability index: | 52.215 | ||
aromaticity | 0.075 | ||
GRAVY | -0.260 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.336 | ||
sheet | 0.185 |