Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CV130374.1 | 5prime_partial | 141 | 3-428(+) |
Amino Acid sequence : | |||
NTSFYPSVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRPDRPAEAGLWSKKRGDAPLPIHGISKITLKVVVFHFRLSAPTYPTPLKSFHKVGLESSSTGSSFPADSAKPVPLAVV SLDSRQGTVGISLIHSCRVTN* | |||
Physicochemical properties | |||
Number of amino acids: | 141 | ||
Molecular weight: | 15,271.359 | ||
Theoretical pI: | 9.463 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 50.845 | ||
aromaticity | 0.071 | ||
GRAVY | -0.071 | ||
Secondary Structure Fraction | |||
Helix | 0.326 | ||
turn | 0.333 | ||
sheet | 0.184 |