Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CV130412.1 | 5prime_partial | 133 | 1-402(+) |
Amino Acid sequence : | |||
TSSLYFHKTKHLSIIGNNSTYMYNCSLIQTNSKYFNKQKRCKASLYQYTYLGADMRVSKEVILTSLVASDCLLFGSLKKFIRDLMISLGVILSRHLHYASVSGVFDRHNVADLLQLVSQH VSLEQRVPPGITG* | |||
Physicochemical properties | |||
Number of amino acids: | 133 | ||
Molecular weight: | 12,306.566 | ||
Theoretical pI: | 4.650 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18825 | ||
Instability index: | 41.898 | ||
aromaticity | 0.082 | ||
GRAVY | -0.610 | ||
Secondary Structure Fraction | |||
Helix | 0.245 | ||
turn | 0.218 | ||
sheet | 0.245 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CV130412.1 | 5prime_partial | 110 | 483-151(-) |
Amino Acid sequence : | |||
SNPPGCDEWNIRRCQTGLPVDKSSWESSACYPRRYTLFEGDMLGDKLEKISNVMTVEDTGDGCVVKVTTEYHTKGDHEVPDELLKAAEEQAITSYKACEDYLFANPHVCA* | |||
Physicochemical properties | |||
Number of amino acids: | 110 | ||
Molecular weight: | 12,306.566 | ||
Theoretical pI: | 4.650 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18825 | ||
Instability index: | 41.898 | ||
aromaticity | 0.082 | ||
GRAVY | -0.610 | ||
Secondary Structure Fraction | |||
Helix | 0.245 | ||
turn | 0.218 | ||
sheet | 0.245 |