Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CV130417.1 | 5prime_partial | 126 | 3-383(+) |
Amino Acid sequence : | |||
SSLYFHKTKHLSIIGNNSTYMYNCSLIQTNSKYFNKQKRCKASLYQYTYLGADMRVSKEVILTSLVASDCLLFGSLKEVHQGPHDPPWGVILRSSPSLRIRFPGVFDRINVGLDLLQALV SKHGLP* | |||
Physicochemical properties | |||
Number of amino acids: | 126 | ||
Molecular weight: | 14,233.338 | ||
Theoretical pI: | 9.603 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
Instability index: | 41.731 | ||
aromaticity | 0.103 | ||
GRAVY | -0.137 | ||
Secondary Structure Fraction | |||
Helix | 0.357 | ||
turn | 0.278 | ||
sheet | 0.198 |