Acc_NO	ORF type	length	start-end position (strand +/-)
>CV130423.1	5prime_partial	134	418-14(-)
Amino Acid sequence :
YPVEIRNTPNNLVNILFRSECRLKKPFRDLKSPAYGLGLRPSRTSSSERFDIMLLIALMLQLTCWLAGVHAQKQGWDKHFQANTVRNRNVLSTVRLGMEVLRHSGYTITREDLLVAATLL AQNLFTHGYALGKL*
Physicochemical properties
Number of amino acids:		134
Molecular weight:		15,266.621
Theoretical pI:		10.168
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		16960 17085
Instability index:		51.137
aromaticity		0.082
GRAVY		-0.131
Secondary Structure Fraction
Helix		0.343
turn		0.216
sheet		0.291