Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CV130423.1 | 5prime_partial | 134 | 418-14(-) |
Amino Acid sequence : | |||
YPVEIRNTPNNLVNILFRSECRLKKPFRDLKSPAYGLGLRPSRTSSSERFDIMLLIALMLQLTCWLAGVHAQKQGWDKHFQANTVRNRNVLSTVRLGMEVLRHSGYTITREDLLVAATLL AQNLFTHGYALGKL* | |||
Physicochemical properties | |||
Number of amino acids: | 134 | ||
Molecular weight: | 15,266.621 | ||
Theoretical pI: | 10.168 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
Instability index: | 51.137 | ||
aromaticity | 0.082 | ||
GRAVY | -0.131 | ||
Secondary Structure Fraction | |||
Helix | 0.343 | ||
turn | 0.216 | ||
sheet | 0.291 |