| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DI407455.1 | complete | 464 | 1-1395(+) |
Amino Acid sequence : | |||
| MEAGGDKLHIVVFPWLAFGHMLPFLELSKSLAKRGHLISFVSTPKNIQRFPNLPPQISPLINFIPLSLPKVEGMPGDVEATTDLPPANLQYLKKALDGLEQPFRSFLREASPKPDWIIQD LLQHWIPPIAAELHVPSMYFGTVPAAALTFFGHPSQLSSRGKGLEGWLASPPWVPFPSKVAYRLHELIVMAKDAAGPLHSGMTDARRMEAAIVGCCAVAIRTCRELESEWLPILEEIYGK PVIPVGLLLPTADESTDGNSIIDWLGTRSQESVVYIALGSEVSIGVELIHELALGLELAGLPFLWALRRPYGLSSDTEILPGGFEERTRGYGKVVMGWVPQMRVLADRSVGGFVTHCGWS SVVESLHFGHPLVLLPIFGDQGLNARLLEEKGIGVEVERKGDGSFTRNEVAKAINLIMVEGDGSGSSYRKKAKEMKKIFADKECQEKYVDEFVQFLLSNGTAKG* | |||
Physicochemical properties | |||
| Number of amino acids: | 464 | ||
| Molecular weight: | 16,535.780 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 87.070 | ||
| aromaticity | 0.041 | ||
| GRAVY | -1.005 | ||
Secondary Structure Fraction | |||
| Helix | 0.184 | ||
| turn | 0.340 | ||
| sheet | 0.177 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DI407455.1 | 5prime_partial | 218 | 1395-739(-) |
Amino Acid sequence : | |||
| LPFCCSITEQELNKLIHILLLAFFVCENLLHLLRFLPIRTTRSIPFHHDQIDRLRHLIPRKRPVPLPLHLDPDPFLLQQPRVEPLVPEYRQQNKRVSKMQALHHRTPTAVRHESSHRPIG QHPHLWDPPHHHLPVPPRPLLEAPGQDLGIARQPVRPPESPKERQPRELEAERQLVYQLHTDGHLAPQRDVHHRFLASRAEPIDNTIAIGAFVGSRQQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 218 | ||
| Molecular weight: | 16,535.780 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 87.070 | ||
| aromaticity | 0.041 | ||
| GRAVY | -1.005 | ||
Secondary Structure Fraction | |||
| Helix | 0.184 | ||
| turn | 0.340 | ||
| sheet | 0.177 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DI407455.1 | complete | 180 | 1253-711(-) |
Amino Acid sequence : | |||
| MIRLIAFATSFLVKDPSPFLSTSTPIPFSSNSLALSPWSPNIGNKTSGCPKCKLSTTELQPQCVTNPPTDLSANTLICGTHPITTFPYPLVRSSKPPGRISVSLDNPYGLLRAQRKGNPA SSRPSASSCISSTPMDTSLPNAMYTTDSWLRVPSQSIILLPSVLSSAVGSSRPTGITGFP* | |||
Physicochemical properties | |||
| Number of amino acids: | 180 | ||
| Molecular weight: | 16,535.780 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 87.070 | ||
| aromaticity | 0.041 | ||
| GRAVY | -1.005 | ||
Secondary Structure Fraction | |||
| Helix | 0.184 | ||
| turn | 0.340 | ||
| sheet | 0.177 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DI407455.1 | complete | 147 | 42-485(+) |
Amino Acid sequence : | |||
| MASLRPHASFPRALKISRKERPSHILRIHPKEHPEIPKSPSTNISSHKFHPFITPQSGRHARRRRGHHRPPAGKPPVPQKSPRRPRAAFPELPPRSFPQTRLDNPRPSSALDTTNSGRAP RAVDVLRHGAGRSVDFLRPPVAVVEPR* | |||
Physicochemical properties | |||
| Number of amino acids: | 147 | ||
| Molecular weight: | 16,535.780 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 87.070 | ||
| aromaticity | 0.041 | ||
| GRAVY | -1.005 | ||
Secondary Structure Fraction | |||
| Helix | 0.184 | ||
| turn | 0.340 | ||
| sheet | 0.177 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DI407455.1 | complete | 464 | 1-1395(+) |
Amino Acid sequence : | |||
| MEAGGDKLHIVVFPWLAFGHMLPFLELSKSLAKRGHLISFVSTPKNIQRFPNLPPQISPLINFIPLSLPKVEGMPGDVEATTDLPPANLQYLKKALDGLEQPFRSFLREASPKPDWIIQD LLQHWIPPIAAELHVPSMYFGTVPAAALTFFGHPSQLSSRGKGLEGWLASPPWVPFPSKVAYRLHELIVMAKDAAGPLHSGMTDARRMEAAIVGCCAVAIRTCRELESEWLPILEEIYGK PVIPVGLLLPTADESTDGNSIIDWLGTRSQESVVYIALGSEVSIGVELIHELALGLELAGLPFLWALRRPYGLSSDTEILPGGFEERTRGYGKVVMGWVPQMRVLADRSVGGFVTHCGWS SVVESLHFGHPLVLLPIFGDQGLNARLLEEKGIGVEVERKGDGSFTRNEVAKAINLIMVEGDGSGSSYRKKAKEMKKIFADKECQEKYVDEFVQFLLSNGTAKG* | |||
Physicochemical properties | |||
| Number of amino acids: | 464 | ||
| Molecular weight: | 16,535.780 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 87.070 | ||
| aromaticity | 0.041 | ||
| GRAVY | -1.005 | ||
Secondary Structure Fraction | |||
| Helix | 0.184 | ||
| turn | 0.340 | ||
| sheet | 0.177 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DI407455.1 | 5prime_partial | 218 | 1395-739(-) |
Amino Acid sequence : | |||
| LPFCCSITEQELNKLIHILLLAFFVCENLLHLLRFLPIRTTRSIPFHHDQIDRLRHLIPRKRPVPLPLHLDPDPFLLQQPRVEPLVPEYRQQNKRVSKMQALHHRTPTAVRHESSHRPIG QHPHLWDPPHHHLPVPPRPLLEAPGQDLGIARQPVRPPESPKERQPRELEAERQLVYQLHTDGHLAPQRDVHHRFLASRAEPIDNTIAIGAFVGSRQQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 218 | ||
| Molecular weight: | 16,535.780 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 87.070 | ||
| aromaticity | 0.041 | ||
| GRAVY | -1.005 | ||
Secondary Structure Fraction | |||
| Helix | 0.184 | ||
| turn | 0.340 | ||
| sheet | 0.177 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DI407455.1 | complete | 180 | 1253-711(-) |
Amino Acid sequence : | |||
| MIRLIAFATSFLVKDPSPFLSTSTPIPFSSNSLALSPWSPNIGNKTSGCPKCKLSTTELQPQCVTNPPTDLSANTLICGTHPITTFPYPLVRSSKPPGRISVSLDNPYGLLRAQRKGNPA SSRPSASSCISSTPMDTSLPNAMYTTDSWLRVPSQSIILLPSVLSSAVGSSRPTGITGFP* | |||
Physicochemical properties | |||
| Number of amino acids: | 180 | ||
| Molecular weight: | 16,535.780 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 87.070 | ||
| aromaticity | 0.041 | ||
| GRAVY | -1.005 | ||
Secondary Structure Fraction | |||
| Helix | 0.184 | ||
| turn | 0.340 | ||
| sheet | 0.177 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DI407455.1 | complete | 147 | 42-485(+) |
Amino Acid sequence : | |||
| MASLRPHASFPRALKISRKERPSHILRIHPKEHPEIPKSPSTNISSHKFHPFITPQSGRHARRRRGHHRPPAGKPPVPQKSPRRPRAAFPELPPRSFPQTRLDNPRPSSALDTTNSGRAP RAVDVLRHGAGRSVDFLRPPVAVVEPR* | |||
Physicochemical properties | |||
| Number of amino acids: | 147 | ||
| Molecular weight: | 16,535.780 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 87.070 | ||
| aromaticity | 0.041 | ||
| GRAVY | -1.005 | ||
Secondary Structure Fraction | |||
| Helix | 0.184 | ||
| turn | 0.340 | ||
| sheet | 0.177 | ||