Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DQ005577.1 | 5prime_partial | 175 | 3-530(+) |
Amino Acid sequence : | |||
SVLCEAKVSLLVFSSSGKLYEFCSPATSLPQILEKYHQHSGQKLWDAKHEKLSAEIDRIRKENDNMQMELRHLKGEDLTSLQPVELGVIEDCLQRGIDAIQPKKWEYLKKLKVKNKSLEE KNESLSFVLQQQLTINGNVREMENGYHEKEREYPSQISLGFRVQPFQPNLQETLQ* | |||
Physicochemical properties | |||
Number of amino acids: | 175 | ||
Molecular weight: | 20,312.922 | ||
Theoretical pI: | 6.228 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18575 | ||
Instability index: | 46.494 | ||
aromaticity | 0.069 | ||
GRAVY | -0.717 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.217 | ||
sheet | 0.291 |