Acc_NO	ORF type	length	start-end position (strand +/-)
>DQ222318.1	complete	247	42-785(+)
Amino Acid sequence :
MGYLRSSFVFFLLTFVTYTYATSFEVRNNCPYTVWAASTPIGGGRRLDRGQTWVINAPRGTSMARIWGRTNCNFDGAGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFSNLDFWDIS LVDGFNIPMTFAPTNPSGGKCHSIQCTANINGECPAALRVPGGCNNPCTTFGGQQYCCTQGPCGPTELSKFFKQRCPDAYSYPQDDPTSTFTCPSDSTNYRVVFCPNGVTSPNFPLEMPS STDEVAK*
Physicochemical properties
Number of amino acids:		247
Molecular weight:		14,493.413
Theoretical pI:		9.513
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		19480 19605
Instability index:		49.123
aromaticity		0.081
GRAVY		0.628
Secondary Structure Fraction
Helix		0.484
turn		0.161
sheet		0.290

Acc_NO	ORF type	length	start-end position (strand +/-)
>DQ222318.1	complete	124	493-867(+)
Amino Acid sequence :
MVNVLLHLEYPEDVTILVPRSEDNNIVAPKVHVVLRNCQNFSNKDALMHIVTHKMILLAHLLVLVIVQIIGLSFVLMVLLAQISPWRCLQVLMKWLSKIKSLSLFKNFFEVVKRYWLVIN LRHE*
Physicochemical properties
Number of amino acids:		124
Molecular weight:		14,493.413
Theoretical pI:		9.513
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		19480 19605
Instability index:		49.123
aromaticity		0.081
GRAVY		0.628
Secondary Structure Fraction
Helix		0.484
turn		0.161
sheet		0.290