| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DQ229901.1 | internal | 194 | 1-582(+) |
Amino Acid sequence : | |||
| SFVSRSNSDSWDIEDENAEQLIIEEDSRRGPCAAATTLGCVVPPPPVRQIAPMVPQRPAKVALSQAEKPAPIIIPALSEDDEEIIQSVVQGKTPSYSLESKLGDCLRAASIRKEALQRIT GKSLEGLPLEGFDYESILGQCCEMPVGYVQIPVGIAGPLLLDGREYSVPMATTEGCLVASTNRGCKAIFVSGGA | |||
Physicochemical properties | |||
| Number of amino acids: | 194 | ||
| Molecular weight: | 20,613.306 | ||
| Theoretical pI: | 4.608 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
| Instability index: | 58.864 | ||
| aromaticity | 0.041 | ||
| GRAVY | -0.068 | ||
Secondary Structure Fraction | |||
| Helix | 0.273 | ||
| turn | 0.278 | ||
| sheet | 0.278 | ||