| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DQ231247.1 | complete | 210 | 68-700(+) |
Amino Acid sequence : | |||
| MGRGKIEIKRIENSTNRQVTFSKRRNGIIKKAREISVLCESQVSVVIFSNSGKLSDYCSSNTSLPKILERYQLNCGKKLWDAKHENLSAQIDRIKKENDNMQIELRHLKGEDLNSLNPKE LIPIEEALTNGLTSVQDKQMDYLKMLKKNERLLEEENKRLTYILHHQQLAMEGNMRELDLGHQHEDREHATQMPMAFTVQPFQPNLQGNK* | |||
Physicochemical properties | |||
| Number of amino acids: | 210 | ||
| Molecular weight: | 24,382.633 | ||
| Theoretical pI: | 8.885 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 42.627 | ||
| aromaticity | 0.043 | ||
| GRAVY | -0.835 | ||
Secondary Structure Fraction | |||
| Helix | 0.257 | ||
| turn | 0.224 | ||
| sheet | 0.281 | ||