Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DQ231247.1 | complete | 210 | 68-700(+) |
Amino Acid sequence : | |||
MGRGKIEIKRIENSTNRQVTFSKRRNGIIKKAREISVLCESQVSVVIFSNSGKLSDYCSSNTSLPKILERYQLNCGKKLWDAKHENLSAQIDRIKKENDNMQIELRHLKGEDLNSLNPKE LIPIEEALTNGLTSVQDKQMDYLKMLKKNERLLEEENKRLTYILHHQQLAMEGNMRELDLGHQHEDREHATQMPMAFTVQPFQPNLQGNK* | |||
Physicochemical properties | |||
Number of amino acids: | 210 | ||
Molecular weight: | 24,382.633 | ||
Theoretical pI: | 8.885 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
Instability index: | 42.627 | ||
aromaticity | 0.043 | ||
GRAVY | -0.835 | ||
Secondary Structure Fraction | |||
Helix | 0.257 | ||
turn | 0.224 | ||
sheet | 0.281 |