| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DQ231250.1 | 5prime_partial | 236 | 2-712(+) |
Amino Acid sequence : | |||
| SSSTCYNHLITINFLVLVLFLVSFLPMGRGKIEIKRIENSTNRQVTFSKRRNGIIKKAREISVLCECEVSLVIFSSLGKMSEYCSPNTKLPKILEKYQQNSGKRLWEAKHENLSAEIERI KRENDNMQIELRHLKGEDLNSLHPKELIPIEEALQNGLTGVREKQMDFLKMMKKNERLMEEENKRLTYLLHHQQLAMEGNMRDMDLGYQQKERAYPSQMPMTFRMQPIQPNLQEAK* | |||
Physicochemical properties | |||
| Number of amino acids: | 236 | ||
| Molecular weight: | 14,061.846 | ||
| Theoretical pI: | 9.782 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 51.685 | ||
| aromaticity | 0.132 | ||
| GRAVY | 0.631 | ||
Secondary Structure Fraction | |||
| Helix | 0.446 | ||
| turn | 0.215 | ||
| sheet | 0.306 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DQ231250.1 | complete | 121 | 381-16(-) |
Amino Acid sequence : | |||
| MLSFSLLILSISALRFSCLASQSLFPEFCWYFSNIFGNLVFGLQYSLILPRLEKMTRETSHSQRTLISLAFLMIPFLLLEKVTCLLVEFSILFISIFPLPIGRNDTKNKTKTKKLMVMRW L* | |||
Physicochemical properties | |||
| Number of amino acids: | 121 | ||
| Molecular weight: | 14,061.846 | ||
| Theoretical pI: | 9.782 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 51.685 | ||
| aromaticity | 0.132 | ||
| GRAVY | 0.631 | ||
Secondary Structure Fraction | |||
| Helix | 0.446 | ||
| turn | 0.215 | ||
| sheet | 0.306 | ||