Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DQ231251.1 | 5prime_partial | 230 | 2-694(+) |
Amino Acid sequence : | |||
CYNHLITITIFILFLVSFLPMGRGKIEIKRIENSTNRQVTFSKRRNGIIKKAREISVLCECEVSLVIFSSLGKMSEYCSPNTKLPKILEKYQQNSGKRLWEAKHENLSAEIERIKRENDN MQIELRHLKGEDLNSLHPKELIPIEEALQNGLTGVREKQMDFLKMMKKNERLMEEENKRLTYLLHHQQLAMEGNMRDMDLGYQQKERAYPSQMPMTFRMQPIQPNLQEAK* | |||
Physicochemical properties | |||
Number of amino acids: | 230 | ||
Molecular weight: | 13,851.659 | ||
Theoretical pI: | 9.506 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 58.578 | ||
aromaticity | 0.134 | ||
GRAVY | 0.754 | ||
Secondary Structure Fraction | |||
Helix | 0.454 | ||
turn | 0.218 | ||
sheet | 0.319 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DQ231251.1 | complete | 119 | 363-4(-) |
Amino Acid sequence : | |||
MLSFSLLILSISALRFSCLASQSLFPEFCWYFSNIFGNLVFGLQYSLILPRLEKMTRETSHSQRTLISLAFLMIPFLLLEKVTCLLVEFSILFISIFPLPIGRNDTKNKMKMVMVMRWL* | |||
Physicochemical properties | |||
Number of amino acids: | 119 | ||
Molecular weight: | 13,851.659 | ||
Theoretical pI: | 9.506 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 58.578 | ||
aromaticity | 0.134 | ||
GRAVY | 0.754 | ||
Secondary Structure Fraction | |||
Helix | 0.454 | ||
turn | 0.218 | ||
sheet | 0.319 |