| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DQ231251.1 | 5prime_partial | 230 | 2-694(+) |
Amino Acid sequence : | |||
| CYNHLITITIFILFLVSFLPMGRGKIEIKRIENSTNRQVTFSKRRNGIIKKAREISVLCECEVSLVIFSSLGKMSEYCSPNTKLPKILEKYQQNSGKRLWEAKHENLSAEIERIKRENDN MQIELRHLKGEDLNSLHPKELIPIEEALQNGLTGVREKQMDFLKMMKKNERLMEEENKRLTYLLHHQQLAMEGNMRDMDLGYQQKERAYPSQMPMTFRMQPIQPNLQEAK* | |||
Physicochemical properties | |||
| Number of amino acids: | 230 | ||
| Molecular weight: | 13,851.659 | ||
| Theoretical pI: | 9.506 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 58.578 | ||
| aromaticity | 0.134 | ||
| GRAVY | 0.754 | ||
Secondary Structure Fraction | |||
| Helix | 0.454 | ||
| turn | 0.218 | ||
| sheet | 0.319 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DQ231251.1 | complete | 119 | 363-4(-) |
Amino Acid sequence : | |||
| MLSFSLLILSISALRFSCLASQSLFPEFCWYFSNIFGNLVFGLQYSLILPRLEKMTRETSHSQRTLISLAFLMIPFLLLEKVTCLLVEFSILFISIFPLPIGRNDTKNKMKMVMVMRWL* | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 13,851.659 | ||
| Theoretical pI: | 9.506 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 58.578 | ||
| aromaticity | 0.134 | ||
| GRAVY | 0.754 | ||
Secondary Structure Fraction | |||
| Helix | 0.454 | ||
| turn | 0.218 | ||
| sheet | 0.319 | ||