| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329735.1 | 3prime_partial | 251 | 51-803(+) |
Amino Acid sequence : | |||
| MDSFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKANVNYEKIVRDTCRGIGFISPDVGLDADNCKVLVNIEQQSPDIAQGVHGHLSKKPEEIGA GDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNEDGAMVPVRVHTVLISTQHDETVTNDQIAADLKEHVIKPVIPAQYLDEKTIFHLNPSGRFVI GGPHGDAGLTG | |||
Physicochemical properties | |||
| Number of amino acids: | 251 | ||
| Molecular weight: | 11,231.660 | ||
| Theoretical pI: | 4.767 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
| Instability index: | 43.687 | ||
| aromaticity | 0.061 | ||
| GRAVY | 0.082 | ||
Secondary Structure Fraction | |||
| Helix | 0.364 | ||
| turn | 0.222 | ||
| sheet | 0.232 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329735.1 | 5prime_partial | 99 | 803-504(-) |
Amino Acid sequence : | |||
| TSETGISMWTTNHETPRWVEVEDCLLIEILSRNHRLDDVLFQVSCNLVIRDSLVVLRGDEDCMNSHRNHGTILVFVLDGDLCLTIGSQPWASLVLPHFS* | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 11,231.660 | ||
| Theoretical pI: | 4.767 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
| Instability index: | 43.687 | ||
| aromaticity | 0.061 | ||
| GRAVY | 0.082 | ||
Secondary Structure Fraction | |||
| Helix | 0.364 | ||
| turn | 0.222 | ||
| sheet | 0.232 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329735.1 | 3prime_partial | 251 | 51-803(+) |
Amino Acid sequence : | |||
| MDSFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKANVNYEKIVRDTCRGIGFISPDVGLDADNCKVLVNIEQQSPDIAQGVHGHLSKKPEEIGA GDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNEDGAMVPVRVHTVLISTQHDETVTNDQIAADLKEHVIKPVIPAQYLDEKTIFHLNPSGRFVI GGPHGDAGLTG | |||
Physicochemical properties | |||
| Number of amino acids: | 251 | ||
| Molecular weight: | 11,231.660 | ||
| Theoretical pI: | 4.767 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
| Instability index: | 43.687 | ||
| aromaticity | 0.061 | ||
| GRAVY | 0.082 | ||
Secondary Structure Fraction | |||
| Helix | 0.364 | ||
| turn | 0.222 | ||
| sheet | 0.232 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329735.1 | 5prime_partial | 99 | 803-504(-) |
Amino Acid sequence : | |||
| TSETGISMWTTNHETPRWVEVEDCLLIEILSRNHRLDDVLFQVSCNLVIRDSLVVLRGDEDCMNSHRNHGTILVFVLDGDLCLTIGSQPWASLVLPHFS* | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 11,231.660 | ||
| Theoretical pI: | 4.767 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
| Instability index: | 43.687 | ||
| aromaticity | 0.061 | ||
| GRAVY | 0.082 | ||
Secondary Structure Fraction | |||
| Helix | 0.364 | ||
| turn | 0.222 | ||
| sheet | 0.232 | ||