Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY329752.1 | 5prime_partial | 194 | 856-272(-) |
Amino Acid sequence : | |||
HMKAFTNAMIAHARLTAAAIVSNYPAAFDGLRSVVDVGGRHGTAIGRLVEAFPWVRGIAFDLPEIVADAPPRKGVDFVGGDMFESVPKADAVMLMWILHDWSDNKCIEILKKCKEAIPAS TGKVMIVDAIINEDGEGDEFSGARLSLDMTMLAVMAQGKERTYKEWVHLLNEAGFSKHTVKNIKSIESVIEAYP* | |||
Physicochemical properties | |||
Number of amino acids: | 194 | ||
Molecular weight: | 18,402.774 | ||
Theoretical pI: | 11.852 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
Instability index: | 89.255 | ||
aromaticity | 0.118 | ||
GRAVY | -0.748 | ||
Secondary Structure Fraction | |||
Helix | 0.294 | ||
turn | 0.222 | ||
sheet | 0.137 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY329752.1 | complete | 153 | 353-814(+) |
Amino Acid sequence : | |||
MHPFLISSLLSLRHHRQHCHIQRQTSTRKLVAFSIFVNYSIYNHHFSGTRWNRFFAFLQNFYAFIVAPVMQYPHEHDRVGFRHAFKHVPSDEVDPFTRRSIRHNLRQIKRNSPHPRKRLH QSPDSRSVAAAHIHHRSQSVKRRRIVAYNGSRR* | |||
Physicochemical properties | |||
Number of amino acids: | 153 | ||
Molecular weight: | 18,402.774 | ||
Theoretical pI: | 11.852 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
Instability index: | 89.255 | ||
aromaticity | 0.118 | ||
GRAVY | -0.748 | ||
Secondary Structure Fraction | |||
Helix | 0.294 | ||
turn | 0.222 | ||
sheet | 0.137 |