Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY329765.1 | 5prime_partial | 181 | 942-397(-) |
Amino Acid sequence : | |||
SFSNQSKPALSNSRIHGHMLVLTRPAPKPISIPQKSEIKEPISSSASPTQPQQLADPVKVDSEPDSISLRPQGRTGSAPVVSSSPLSSSPLPSPASLVPSKFVPPHLRPGFVGKEEKPGP ELVKGGFKAKPEFRGHRQVQVQNSGNYGSGAIEGRPKSGGGYDPMRRGYALSDLNRPGSSG* | |||
Physicochemical properties | |||
Number of amino acids: | 181 | ||
Molecular weight: | 15,484.614 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 111.933 | ||
aromaticity | 0.073 | ||
GRAVY | -1.476 | ||
Secondary Structure Fraction | |||
Helix | 0.220 | ||
turn | 0.203 | ||
sheet | 0.220 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY329765.1 | complete | 123 | 535-906(+) |
Amino Acid sequence : | |||
MPSEFRLSLKSTLHELRTRLLLFPHEPRPQMRRHELRRNQRRRRRQRRRTQRRRTHHRSGSGPALRSERNRIRFRIDFYRICELLRLRRRSGGRDRFLDFRFLRDGDRLRSWSGQNEHMS MDP* | |||
Physicochemical properties | |||
Number of amino acids: | 123 | ||
Molecular weight: | 15,484.614 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 111.933 | ||
aromaticity | 0.073 | ||
GRAVY | -1.476 | ||
Secondary Structure Fraction | |||
Helix | 0.220 | ||
turn | 0.203 | ||
sheet | 0.220 |