| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329770.1 | 5prime_partial | 188 | 2-568(+) |
Amino Acid sequence : | |||
| AYTMGSHHNQESHISIKLLDGEEFRRQAHLVTDFLVDYYKNVENYPVQSQVEAEYLKKRIPQSAPCNPEPIEDILDDVQRHIIPGLTHWQSPNFFGYFPCNLSIPSILGEMLCAGFNVPG FNWISSPAATELENTVVDWIGEMLQLPPDFLFAGGGGGVIQGTTCEAILSVIVAARAGPVIYGALCER* | |||
Physicochemical properties | |||
| Number of amino acids: | 188 | ||
| Molecular weight: | 20,792.357 | ||
| Theoretical pI: | 4.725 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27180 | ||
| Instability index: | 52.409 | ||
| aromaticity | 0.101 | ||
| GRAVY | -0.034 | ||
Secondary Structure Fraction | |||
| Helix | 0.335 | ||
| turn | 0.266 | ||
| sheet | 0.245 | ||