Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY329785.1 | internal | 267 | 2-802(+) |
Amino Acid sequence : | |||
FVYTLIAFSSLLYFYLIWSESAKPKTTTHKAPPEASGAWPVIGHLRIMSGHPSAGIPHVNLGMLADKHGPIFSIRLGVHRVVVVSSPEVIKELFTTNDVAVSSRPSVKAGKHLAYDNAML GFASYGAYWRQLRKIVSLELLSNRRLELQSHVSMSETGQFVKELYKLWEKKKSDGSGTEVGEGVVVDMKRWLGELNMNVVMRMVAGKRFGSGDNAEETKRCRRVMRDFFYLAGFFVPADA LPYLGWLDLGGHEKRMKKAAKELDEVV | |||
Physicochemical properties | |||
Number of amino acids: | 267 | ||
Molecular weight: | 11,342.525 | ||
Theoretical pI: | 10.103 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
Instability index: | 76.881 | ||
aromaticity | 0.047 | ||
GRAVY | -0.832 | ||
Secondary Structure Fraction | |||
Helix | 0.132 | ||
turn | 0.425 | ||
sheet | 0.170 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY329785.1 | 5prime_partial | 126 | 802-422(-) |
Amino Acid sequence : | |||
HDFIQLLGSFLHPLLMPTQIQPPQIRQRVRGHKKPRQIEEIPHHPPAPLRLLRIVSAAKSLSSHHPHHHIHVQLSKPPLHIHHHSLTYFCARPITFLLLPQLIKLLNKLTSFRHAHVTLE LQSPIR* | |||
Physicochemical properties | |||
Number of amino acids: | 126 | ||
Molecular weight: | 11,342.525 | ||
Theoretical pI: | 10.103 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
Instability index: | 76.881 | ||
aromaticity | 0.047 | ||
GRAVY | -0.832 | ||
Secondary Structure Fraction | |||
Helix | 0.132 | ||
turn | 0.425 | ||
sheet | 0.170 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY329785.1 | 5prime_partial | 106 | 803-483(-) |
Amino Acid sequence : | |||
PRLHPTPWQLSSSSSHAHPNPATPDTAARPRAQKTPPNRRNPSSPAGTASSPPHCLRCQISFQPPSSSPHSCSTLQATASYPPPLPHLLLCQTHHFSSSPTTYKAP* | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 11,342.525 | ||
Theoretical pI: | 10.103 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
Instability index: | 76.881 | ||
aromaticity | 0.047 | ||
GRAVY | -0.832 | ||
Secondary Structure Fraction | |||
Helix | 0.132 | ||
turn | 0.425 | ||
sheet | 0.170 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY329785.1 | internal | 267 | 2-802(+) |
Amino Acid sequence : | |||
FVYTLIAFSSLLYFYLIWSESAKPKTTTHKAPPEASGAWPVIGHLRIMSGHPSAGIPHVNLGMLADKHGPIFSIRLGVHRVVVVSSPEVIKELFTTNDVAVSSRPSVKAGKHLAYDNAML GFASYGAYWRQLRKIVSLELLSNRRLELQSHVSMSETGQFVKELYKLWEKKKSDGSGTEVGEGVVVDMKRWLGELNMNVVMRMVAGKRFGSGDNAEETKRCRRVMRDFFYLAGFFVPADA LPYLGWLDLGGHEKRMKKAAKELDEVV | |||
Physicochemical properties | |||
Number of amino acids: | 267 | ||
Molecular weight: | 11,342.525 | ||
Theoretical pI: | 10.103 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
Instability index: | 76.881 | ||
aromaticity | 0.047 | ||
GRAVY | -0.832 | ||
Secondary Structure Fraction | |||
Helix | 0.132 | ||
turn | 0.425 | ||
sheet | 0.170 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY329785.1 | 5prime_partial | 126 | 802-422(-) |
Amino Acid sequence : | |||
HDFIQLLGSFLHPLLMPTQIQPPQIRQRVRGHKKPRQIEEIPHHPPAPLRLLRIVSAAKSLSSHHPHHHIHVQLSKPPLHIHHHSLTYFCARPITFLLLPQLIKLLNKLTSFRHAHVTLE LQSPIR* | |||
Physicochemical properties | |||
Number of amino acids: | 126 | ||
Molecular weight: | 11,342.525 | ||
Theoretical pI: | 10.103 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
Instability index: | 76.881 | ||
aromaticity | 0.047 | ||
GRAVY | -0.832 | ||
Secondary Structure Fraction | |||
Helix | 0.132 | ||
turn | 0.425 | ||
sheet | 0.170 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY329785.1 | 5prime_partial | 106 | 803-483(-) |
Amino Acid sequence : | |||
PRLHPTPWQLSSSSSHAHPNPATPDTAARPRAQKTPPNRRNPSSPAGTASSPPHCLRCQISFQPPSSSPHSCSTLQATASYPPPLPHLLLCQTHHFSSSPTTYKAP* | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 11,342.525 | ||
Theoretical pI: | 10.103 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
Instability index: | 76.881 | ||
aromaticity | 0.047 | ||
GRAVY | -0.832 | ||
Secondary Structure Fraction | |||
Helix | 0.132 | ||
turn | 0.425 | ||
sheet | 0.170 |