| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329793.1 | internal | 265 | 2-796(+) |
Amino Acid sequence : | |||
| LNDSGRLEIDCNAAGAGFVAAESEFSLDQIGDLVHPNLGFRQLAVQTLDNVDKDDQPLFILQITSFKCGGFAIGLCVNHILLDGMSAKDFNENLASQAFDDKPLSVVPCFDRRLLAARSP PQPAFDHREFKPNLGPASTPPVFDCTKEHLEYRVFQLYPPHINLLKQKAKPESGRISGLTAAAALMWKCKALSKDESYNGNRVSTLLNVLDLRSRLREPALPPNYCGNALLVAYSTAACG EIAAAEFAELAERVAAAPGRVTEEY | |||
Physicochemical properties | |||
| Number of amino acids: | 265 | ||
| Molecular weight: | 13,694.798 | ||
| Theoretical pI: | 11.167 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 25230 | ||
| Instability index: | 68.925 | ||
| aromaticity | 0.089 | ||
| GRAVY | -0.469 | ||
Secondary Structure Fraction | |||
| Helix | 0.226 | ||
| turn | 0.290 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329793.1 | 3prime_partial | 199 | 202-798(+) |
Amino Acid sequence : | |||
| MRRLRHRTLRKPHLTRRNERQRLQRKPRLASLRRQALIRRPLLRPPPPRRPLAAAAGLRPPRIQTEPRPRLHPSRLRLHQGTPRIPRLPIIPSPHKSPQTKGQTGIRPDQRPHRRGGAHV EMQSAVEGRKLQRKQSFDSVKRARPPVEAEGAGAAAELLRQRAAGGVLDGGVRRDRGGGVRRAGGEGGGGAGEGDGGIC | |||
Physicochemical properties | |||
| Number of amino acids: | 199 | ||
| Molecular weight: | 13,694.798 | ||
| Theoretical pI: | 11.167 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 25230 | ||
| Instability index: | 68.925 | ||
| aromaticity | 0.089 | ||
| GRAVY | -0.469 | ||
Secondary Structure Fraction | |||
| Helix | 0.226 | ||
| turn | 0.290 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329793.1 | complete | 124 | 558-184(-) |
Amino Acid sequence : | |||
| MSAAAAVRPLIRPDSGLAFCLRRFMWGGYNWKTRYSRCSLVQSKTGGVEAGPRFGLNSRWSKAGCGGERAARRRRSKQGTTDKGLSSKACEARFSLKSLALIPSSKMWFTQSPMAKPPHL KEVI* | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 13,694.798 | ||
| Theoretical pI: | 11.167 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 25230 | ||
| Instability index: | 68.925 | ||
| aromaticity | 0.089 | ||
| GRAVY | -0.469 | ||
Secondary Structure Fraction | |||
| Helix | 0.226 | ||
| turn | 0.290 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329793.1 | internal | 265 | 2-796(+) |
Amino Acid sequence : | |||
| LNDSGRLEIDCNAAGAGFVAAESEFSLDQIGDLVHPNLGFRQLAVQTLDNVDKDDQPLFILQITSFKCGGFAIGLCVNHILLDGMSAKDFNENLASQAFDDKPLSVVPCFDRRLLAARSP PQPAFDHREFKPNLGPASTPPVFDCTKEHLEYRVFQLYPPHINLLKQKAKPESGRISGLTAAAALMWKCKALSKDESYNGNRVSTLLNVLDLRSRLREPALPPNYCGNALLVAYSTAACG EIAAAEFAELAERVAAAPGRVTEEY | |||
Physicochemical properties | |||
| Number of amino acids: | 265 | ||
| Molecular weight: | 13,694.798 | ||
| Theoretical pI: | 11.167 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 25230 | ||
| Instability index: | 68.925 | ||
| aromaticity | 0.089 | ||
| GRAVY | -0.469 | ||
Secondary Structure Fraction | |||
| Helix | 0.226 | ||
| turn | 0.290 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329793.1 | 3prime_partial | 199 | 202-798(+) |
Amino Acid sequence : | |||
| MRRLRHRTLRKPHLTRRNERQRLQRKPRLASLRRQALIRRPLLRPPPPRRPLAAAAGLRPPRIQTEPRPRLHPSRLRLHQGTPRIPRLPIIPSPHKSPQTKGQTGIRPDQRPHRRGGAHV EMQSAVEGRKLQRKQSFDSVKRARPPVEAEGAGAAAELLRQRAAGGVLDGGVRRDRGGGVRRAGGEGGGGAGEGDGGIC | |||
Physicochemical properties | |||
| Number of amino acids: | 199 | ||
| Molecular weight: | 13,694.798 | ||
| Theoretical pI: | 11.167 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 25230 | ||
| Instability index: | 68.925 | ||
| aromaticity | 0.089 | ||
| GRAVY | -0.469 | ||
Secondary Structure Fraction | |||
| Helix | 0.226 | ||
| turn | 0.290 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329793.1 | complete | 124 | 558-184(-) |
Amino Acid sequence : | |||
| MSAAAAVRPLIRPDSGLAFCLRRFMWGGYNWKTRYSRCSLVQSKTGGVEAGPRFGLNSRWSKAGCGGERAARRRRSKQGTTDKGLSSKACEARFSLKSLALIPSSKMWFTQSPMAKPPHL KEVI* | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 13,694.798 | ||
| Theoretical pI: | 11.167 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 25230 | ||
| Instability index: | 68.925 | ||
| aromaticity | 0.089 | ||
| GRAVY | -0.469 | ||
Secondary Structure Fraction | |||
| Helix | 0.226 | ||
| turn | 0.290 | ||
| sheet | 0.250 | ||