| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329796.1 | 3prime_partial | 297 | 3-893(+) |
Amino Acid sequence : | |||
| MADTFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTKANIDYEKIVRDTCRSIGFVSDDVGLDADKCKVLVNIEQQSPDIAQGVHGHLTKRPEDIG AGDQGHMFGYATDETPEYMPLSHVLATKLGARLTEVRKDGTCPWLRPDGKTQVTVEYYNENGAMVPIRVHTVLISTQHDETVTNDEIARDLKEHVIKPVIPEKYLDEKTIFHLNPSGRFV IGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTRSTGVEPTLSGRRPRASLPT | |||
Physicochemical properties | |||
| Number of amino acids: | 297 | ||
| Molecular weight: | 13,597.020 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 100.511 | ||
| aromaticity | 0.023 | ||
| GRAVY | -0.823 | ||
Secondary Structure Fraction | |||
| Helix | 0.123 | ||
| turn | 0.469 | ||
| sheet | 0.115 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329796.1 | 3prime_partial | 143 | 431-3(-) |
Amino Acid sequence : | |||
| MTKRHVLGGFVGGVPKHVALVTGPDILRAFGQMAVNALSDIRALLLDVDKNLTLVSIETNIVGNKPNRAAGVAHDLLVVYVGLGCDLSKDHHHVGLGASLTSHLTIRILLEASIENRVGD LIAELVGVPLIHALGGKQEGVRH | |||
Physicochemical properties | |||
| Number of amino acids: | 143 | ||
| Molecular weight: | 13,597.020 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 100.511 | ||
| aromaticity | 0.023 | ||
| GRAVY | -0.823 | ||
Secondary Structure Fraction | |||
| Helix | 0.123 | ||
| turn | 0.469 | ||
| sheet | 0.115 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329796.1 | 3prime_partial | 130 | 505-894(+) |
Amino Acid sequence : | |||
| MGRPRSRSSTTTRTVRWSPSGSTPSSSRLSTTRPSPTTRSPGISRSMSSSRSSPRSIWTRKPSSTLIPPGVSSSVGPMATRVSPAVRSSSTPTAGGGPTAAGPSPGRILPGRQEWSLHCQ AGGQEHRCQR | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 13,597.020 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 100.511 | ||
| aromaticity | 0.023 | ||
| GRAVY | -0.823 | ||
Secondary Structure Fraction | |||
| Helix | 0.123 | ||
| turn | 0.469 | ||
| sheet | 0.115 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329796.1 | 3prime_partial | 297 | 3-893(+) |
Amino Acid sequence : | |||
| MADTFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTKANIDYEKIVRDTCRSIGFVSDDVGLDADKCKVLVNIEQQSPDIAQGVHGHLTKRPEDIG AGDQGHMFGYATDETPEYMPLSHVLATKLGARLTEVRKDGTCPWLRPDGKTQVTVEYYNENGAMVPIRVHTVLISTQHDETVTNDEIARDLKEHVIKPVIPEKYLDEKTIFHLNPSGRFV IGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTRSTGVEPTLSGRRPRASLPT | |||
Physicochemical properties | |||
| Number of amino acids: | 297 | ||
| Molecular weight: | 13,597.020 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 100.511 | ||
| aromaticity | 0.023 | ||
| GRAVY | -0.823 | ||
Secondary Structure Fraction | |||
| Helix | 0.123 | ||
| turn | 0.469 | ||
| sheet | 0.115 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329796.1 | 3prime_partial | 143 | 431-3(-) |
Amino Acid sequence : | |||
| MTKRHVLGGFVGGVPKHVALVTGPDILRAFGQMAVNALSDIRALLLDVDKNLTLVSIETNIVGNKPNRAAGVAHDLLVVYVGLGCDLSKDHHHVGLGASLTSHLTIRILLEASIENRVGD LIAELVGVPLIHALGGKQEGVRH | |||
Physicochemical properties | |||
| Number of amino acids: | 143 | ||
| Molecular weight: | 13,597.020 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 100.511 | ||
| aromaticity | 0.023 | ||
| GRAVY | -0.823 | ||
Secondary Structure Fraction | |||
| Helix | 0.123 | ||
| turn | 0.469 | ||
| sheet | 0.115 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329796.1 | 3prime_partial | 130 | 505-894(+) |
Amino Acid sequence : | |||
| MGRPRSRSSTTTRTVRWSPSGSTPSSSRLSTTRPSPTTRSPGISRSMSSSRSSPRSIWTRKPSSTLIPPGVSSSVGPMATRVSPAVRSSSTPTAGGGPTAAGPSPGRILPGRQEWSLHCQ AGGQEHRCQR | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 13,597.020 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 100.511 | ||
| aromaticity | 0.023 | ||
| GRAVY | -0.823 | ||
Secondary Structure Fraction | |||
| Helix | 0.123 | ||
| turn | 0.469 | ||
| sheet | 0.115 | ||