Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY329803.1 | 5prime_partial | 229 | 1-690(+) |
Amino Acid sequence : | |||
ATMPSVPGKVVCVTCAGGFIASWLVKLLLEKGYTVRGTARNPDDPKNSHLRELEGADERLILCRADLNVYESLREAINGCDGVFHTASPVTDDPEQMVEPAVEGAKNVICAAAEAKVRRV VLTSSIGAIYMDPNRDPDKVVDDTCWSDLSFAKTPRTGTATVRLWRNKLRGRRLRKLTWTSKMWPWPTSSCSRIWLRRGGTSARRASSTAARWWRFLLNYSLSILYRPS* | |||
Physicochemical properties | |||
Number of amino acids: | 229 | ||
Molecular weight: | 25,599.122 | ||
Theoretical pI: | 9.673 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 56950 57325 | ||
Instability index: | 39.852 | ||
aromaticity | 0.079 | ||
GRAVY | -0.314 | ||
Secondary Structure Fraction | |||
Helix | 0.284 | ||
turn | 0.236 | ||
sheet | 0.245 |