| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329803.1 | 5prime_partial | 229 | 1-690(+) |
Amino Acid sequence : | |||
| ATMPSVPGKVVCVTCAGGFIASWLVKLLLEKGYTVRGTARNPDDPKNSHLRELEGADERLILCRADLNVYESLREAINGCDGVFHTASPVTDDPEQMVEPAVEGAKNVICAAAEAKVRRV VLTSSIGAIYMDPNRDPDKVVDDTCWSDLSFAKTPRTGTATVRLWRNKLRGRRLRKLTWTSKMWPWPTSSCSRIWLRRGGTSARRASSTAARWWRFLLNYSLSILYRPS* | |||
Physicochemical properties | |||
| Number of amino acids: | 229 | ||
| Molecular weight: | 25,599.122 | ||
| Theoretical pI: | 9.673 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 56950 57325 | ||
| Instability index: | 39.852 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.314 | ||
Secondary Structure Fraction | |||
| Helix | 0.284 | ||
| turn | 0.236 | ||
| sheet | 0.245 | ||