| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329809.1 | 3prime_partial | 220 | 58-717(+) |
Amino Acid sequence : | |||
| MAFAARLLSRSSRQVYDGQSVLRSEYAIPARSFAKGAGGAPPPSKGDSGAPPARPASKGDEMLKGIFLEIKNKFETAMGILRKEKITIDPEDPAAVAHYAKVMKTVREKADLFSESQKIK HTIETKTEGIQDVRTYLVIMMGIRIRMGLVDELGAEAMMMDALDKVEEQLKKPLMRNDKKGMELLKAEFDKVKPKLGIRQEDLPKLEEQVELKIAKAQFE | |||
Physicochemical properties | |||
| Number of amino acids: | 220 | ||
| Molecular weight: | 11,586.302 | ||
| Theoretical pI: | 9.421 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 61.110 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.042 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.283 | ||
| sheet | 0.330 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329809.1 | 3prime_partial | 106 | 320-3(-) |
Amino Acid sequence : | |||
| MVIFSFLRIPMAVSNLFLISRNIPFNISSPFEAGRAGGAPLSPLEGGGAPPAPLAKERAGIAYSDRRTLCPSYTWREDLESKRAAKAIVELEERLTDLSLLIQRKG | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 11,586.302 | ||
| Theoretical pI: | 9.421 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 61.110 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.042 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.283 | ||
| sheet | 0.330 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329809.1 | 3prime_partial | 220 | 58-717(+) |
Amino Acid sequence : | |||
| MAFAARLLSRSSRQVYDGQSVLRSEYAIPARSFAKGAGGAPPPSKGDSGAPPARPASKGDEMLKGIFLEIKNKFETAMGILRKEKITIDPEDPAAVAHYAKVMKTVREKADLFSESQKIK HTIETKTEGIQDVRTYLVIMMGIRIRMGLVDELGAEAMMMDALDKVEEQLKKPLMRNDKKGMELLKAEFDKVKPKLGIRQEDLPKLEEQVELKIAKAQFE | |||
Physicochemical properties | |||
| Number of amino acids: | 220 | ||
| Molecular weight: | 11,586.302 | ||
| Theoretical pI: | 9.421 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 61.110 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.042 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.283 | ||
| sheet | 0.330 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329809.1 | 3prime_partial | 106 | 320-3(-) |
Amino Acid sequence : | |||
| MVIFSFLRIPMAVSNLFLISRNIPFNISSPFEAGRAGGAPLSPLEGGGAPPAPLAKERAGIAYSDRRTLCPSYTWREDLESKRAAKAIVELEERLTDLSLLIQRKG | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 11,586.302 | ||
| Theoretical pI: | 9.421 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 61.110 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.042 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.283 | ||
| sheet | 0.330 | ||