Acc_NO	ORF type	length	start-end position (strand +/-)
>DY329813.1	complete	194	210-794(+)
Amino Acid sequence :
MEGVVGGEGPSSAATALNQRSQEMWRLFQFYLDKSTPHSTYRWIGTFLLVALYALRVYYAQGFYIVTYGLGIYILNLLIGFLSPLVDPEVEGPVLPTKGSDEFKPFIRRLPEFKFWYAVT KAFCIAFVMTFFSMFDVPVFWPILLCYWFVLFVLTMKRQITHMIKYQYLPFNIGKQKYKGKKPAAGSSSSPRGD*
Physicochemical properties
Number of amino acids:		194
Molecular weight:		22,344.996
Theoretical pI:		9.451
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		46870 46995
Instability index:		46.548
aromaticity		0.186
GRAVY		0.206
Secondary Structure Fraction
Helix		0.418
turn		0.222
sheet		0.227