Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY329833.1 | 5prime_partial | 199 | 2-601(+) |
Amino Acid sequence : | |||
AAYNEGRVTINGAKESTVNAYKKQFQSDLGVFLRSRSKELKPGGSMFLMLLGRTSPDPADQGAWILTFSTRYQDAWNDLVQEGLISSEKRDTFNIPIYTPSLEEFKEVVERDGAFIINKL QLFHGGSALIIDDPNDAVEISRAYVSLCRSLTGGLVDAHIGDQLGHELFSRLLSQAVDQAKELMDQFQLVHIVASLTLA* | |||
Physicochemical properties | |||
Number of amino acids: | 199 | ||
Molecular weight: | 22,036.668 | ||
Theoretical pI: | 5.087 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
Instability index: | 41.147 | ||
aromaticity | 0.085 | ||
GRAVY | -0.151 | ||
Secondary Structure Fraction | |||
Helix | 0.327 | ||
turn | 0.226 | ||
sheet | 0.276 |