| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329834.1 | 5prime_partial | 234 | 808-104(-) |
Amino Acid sequence : | |||
| RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGGDI* | |||
Physicochemical properties | |||
| Number of amino acids: | 234 | ||
| Molecular weight: | 18,127.791 | ||
| Theoretical pI: | 7.098 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 61.480 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.140 | ||
Secondary Structure Fraction | |||
| Helix | 0.368 | ||
| turn | 0.181 | ||
| sheet | 0.258 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329834.1 | complete | 155 | 140-607(+) |
Amino Acid sequence : | |||
| MQSRLFLDVIISQRTPILQLLPSKDQPLLIRWNAFLILDLRLHVINGVRALHLQSDRLSSQRLHEDLHSTTQPQHQMQGRLLLDIVVRQSPPIFQLFASEDQPLLIRWDSFLVLYLCLHV VDCIRALHFQRDRLAGQSFDEDLHPSTKPQNQMQS* | |||
Physicochemical properties | |||
| Number of amino acids: | 155 | ||
| Molecular weight: | 18,127.791 | ||
| Theoretical pI: | 7.098 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 61.480 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.140 | ||
Secondary Structure Fraction | |||
| Helix | 0.368 | ||
| turn | 0.181 | ||
| sheet | 0.258 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329834.1 | 5prime_partial | 234 | 808-104(-) |
Amino Acid sequence : | |||
| RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGGDI* | |||
Physicochemical properties | |||
| Number of amino acids: | 234 | ||
| Molecular weight: | 18,127.791 | ||
| Theoretical pI: | 7.098 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 61.480 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.140 | ||
Secondary Structure Fraction | |||
| Helix | 0.368 | ||
| turn | 0.181 | ||
| sheet | 0.258 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329834.1 | complete | 155 | 140-607(+) |
Amino Acid sequence : | |||
| MQSRLFLDVIISQRTPILQLLPSKDQPLLIRWNAFLILDLRLHVINGVRALHLQSDRLSSQRLHEDLHSTTQPQHQMQGRLLLDIVVRQSPPIFQLFASEDQPLLIRWDSFLVLYLCLHV VDCIRALHFQRDRLAGQSFDEDLHPSTKPQNQMQS* | |||
Physicochemical properties | |||
| Number of amino acids: | 155 | ||
| Molecular weight: | 18,127.791 | ||
| Theoretical pI: | 7.098 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 61.480 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.140 | ||
Secondary Structure Fraction | |||
| Helix | 0.368 | ||
| turn | 0.181 | ||
| sheet | 0.258 | ||