| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329835.1 | internal | 304 | 1-912(+) |
Amino Acid sequence : | |||
| LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTL HLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKARIQDKEGIPPDQQRLIFAGEQLEDGRT | |||
Physicochemical properties | |||
| Number of amino acids: | 304 | ||
| Molecular weight: | 16,579.931 | ||
| Theoretical pI: | 7.263 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 59.030 | ||
| aromaticity | 0.063 | ||
| GRAVY | -0.254 | ||
Secondary Structure Fraction | |||
| Helix | 0.352 | ||
| turn | 0.190 | ||
| sheet | 0.254 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329835.1 | 5prime_partial | 142 | 912-484(-) |
Amino Acid sequence : | |||
| RTPILQLLPSKDQPLLIRWNAFLILDPRLHVINGVRALHLQSDRLSSQRLHEDLHSTTQPQHQMQGRLLLDIVVRQSPPIFQLFASEDQPLLIRWDSFLVLYLCLHVVDCIRALHFQRDR LAGQSFDEDLHPSTKPQNQMQS* | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 16,579.931 | ||
| Theoretical pI: | 7.263 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 59.030 | ||
| aromaticity | 0.063 | ||
| GRAVY | -0.254 | ||
Secondary Structure Fraction | |||
| Helix | 0.352 | ||
| turn | 0.190 | ||
| sheet | 0.254 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329835.1 | internal | 304 | 1-912(+) |
Amino Acid sequence : | |||
| LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTL HLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKARIQDKEGIPPDQQRLIFAGEQLEDGRT | |||
Physicochemical properties | |||
| Number of amino acids: | 304 | ||
| Molecular weight: | 16,579.931 | ||
| Theoretical pI: | 7.263 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 59.030 | ||
| aromaticity | 0.063 | ||
| GRAVY | -0.254 | ||
Secondary Structure Fraction | |||
| Helix | 0.352 | ||
| turn | 0.190 | ||
| sheet | 0.254 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329835.1 | 5prime_partial | 142 | 912-484(-) |
Amino Acid sequence : | |||
| RTPILQLLPSKDQPLLIRWNAFLILDPRLHVINGVRALHLQSDRLSSQRLHEDLHSTTQPQHQMQGRLLLDIVVRQSPPIFQLFASEDQPLLIRWDSFLVLYLCLHVVDCIRALHFQRDR LAGQSFDEDLHPSTKPQNQMQS* | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 16,579.931 | ||
| Theoretical pI: | 7.263 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 59.030 | ||
| aromaticity | 0.063 | ||
| GRAVY | -0.254 | ||
Secondary Structure Fraction | |||
| Helix | 0.352 | ||
| turn | 0.190 | ||
| sheet | 0.254 | ||