| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329850.1 | internal | 146 | 2-439(+) |
Amino Acid sequence : | |||
| ERSRLAQSFDYNYGDFIPLLRPFLKGYLAKCRDLQSRRLAFFNNYYVEKRRKIMAENGEKHKISCAIDHIIDAQMKGEISEANVLYIVENINVAAIETTLWSMEWAIAELANHPTIQQKI RDEISAVLGKQSVTESNLHQLPYLQA | |||
Physicochemical properties | |||
| Number of amino acids: | 146 | ||
| Molecular weight: | 16,888.137 | ||
| Theoretical pI: | 7.161 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21555 | ||
| Instability index: | 59.577 | ||
| aromaticity | 0.096 | ||
| GRAVY | -0.335 | ||
Secondary Structure Fraction | |||
| Helix | 0.329 | ||
| turn | 0.185 | ||
| sheet | 0.295 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329850.1 | internal | 146 | 2-439(+) |
Amino Acid sequence : | |||
| ERSRLAQSFDYNYGDFIPLLRPFLKGYLAKCRDLQSRRLAFFNNYYVEKRRKIMAENGEKHKISCAIDHIIDAQMKGEISEANVLYIVENINVAAIETTLWSMEWAIAELANHPTIQQKI RDEISAVLGKQSVTESNLHQLPYLQA | |||
Physicochemical properties | |||
| Number of amino acids: | 146 | ||
| Molecular weight: | 16,888.137 | ||
| Theoretical pI: | 7.161 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21555 | ||
| Instability index: | 59.577 | ||
| aromaticity | 0.096 | ||
| GRAVY | -0.335 | ||
Secondary Structure Fraction | |||
| Helix | 0.329 | ||
| turn | 0.185 | ||
| sheet | 0.295 | ||