| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329851.1 | 5prime_partial | 255 | 970-203(-) |
Amino Acid sequence : | |||
| RATGGGPVLSSAPHCSLKFVHPIPPLFSKRRPSLSSSRTLKPLILANATEPSGAAKPTTSSSAPFDDQGSNPNPITFVGQENVPLEGVIQFEKPDSSSLLAKWGLVAVLAGGDVAALLLF AAIGRLSHGFSVFDFETFKTADPFIAGWFLSAYFLGGYSKDGRGKNGLQKAVIAAAKSWSLGIPLGLIIRAVAVGHPPPTNFILVTMGSTAVVLIGWRALFFTIFPSDKGKKNDVYRRGS PFELFELLTSLVRRW* | |||
Physicochemical properties | |||
| Number of amino acids: | 255 | ||
| Molecular weight: | 15,078.644 | ||
| Theoretical pI: | 10.655 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 31.557 | ||
| aromaticity | 0.081 | ||
| GRAVY | -0.274 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.294 | ||
| sheet | 0.243 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329851.1 | complete | 136 | 180-590(+) |
Amino Acid sequence : | |||
| MKIRLKRHHHLLTNDVSNSKSSKGLPRLYTSFFLPLSEGKMVKNKALQPISTTAVLPIVTNMKLVGGGWPTATALMINPNGIPKDQDFAAAITAFWRPFFPRPSLLYPPRKYALKNHPAM KGSAVLKVSKSKTENP* | |||
Physicochemical properties | |||
| Number of amino acids: | 136 | ||
| Molecular weight: | 15,078.644 | ||
| Theoretical pI: | 10.655 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 31.557 | ||
| aromaticity | 0.081 | ||
| GRAVY | -0.274 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.294 | ||
| sheet | 0.243 | ||