| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329852.1 | 5prime_partial | 261 | 2-787(+) |
Amino Acid sequence : | |||
| VPLLTPPANGGGPVLSSAPHCSLKFVHPIPPLFSKRRPSLSSSRTLKPLILANATEPSGAAKPTTSSSAPFDDQGSNPNPITFVGQENVPLEGVIQFEKPDSSSLLAKWGLVAVLAGGDV AALLLFAAIGRLSHGFSVFDFETFKTADPFIAGWFLSAYFLGGYSKDGRGKNGLQKAVIAAAKSWSLGIPLGLIIRAVAVGHPPPTNFILVTMGSTAVVLIGWRALFFTIFPSDKGKKND VYRRGSPFELFELLTSLVRRW* | |||
Physicochemical properties | |||
| Number of amino acids: | 261 | ||
| Molecular weight: | 15,925.617 | ||
| Theoretical pI: | 10.699 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
| Instability index: | 31.594 | ||
| aromaticity | 0.084 | ||
| GRAVY | -0.334 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.287 | ||
| sheet | 0.238 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329852.1 | 5prime_partial | 143 | 831-400(-) |
Amino Acid sequence : | |||
| TKGYLQRMKIRLKRHHHLLTNDVSNSKSSKGLPRLYTSFFLPLSEGKMVKNKALQPISTTAVLPIVTNMKLVGGGWPTATALMINPNGIPKDQDFAAAITAFWRPFFPRPSLLYPPRKYA LKNHPAMKGSAVLKVSKSKTENP* | |||
Physicochemical properties | |||
| Number of amino acids: | 143 | ||
| Molecular weight: | 15,925.617 | ||
| Theoretical pI: | 10.699 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
| Instability index: | 31.594 | ||
| aromaticity | 0.084 | ||
| GRAVY | -0.334 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.287 | ||
| sheet | 0.238 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329852.1 | 5prime_partial | 261 | 2-787(+) |
Amino Acid sequence : | |||
| VPLLTPPANGGGPVLSSAPHCSLKFVHPIPPLFSKRRPSLSSSRTLKPLILANATEPSGAAKPTTSSSAPFDDQGSNPNPITFVGQENVPLEGVIQFEKPDSSSLLAKWGLVAVLAGGDV AALLLFAAIGRLSHGFSVFDFETFKTADPFIAGWFLSAYFLGGYSKDGRGKNGLQKAVIAAAKSWSLGIPLGLIIRAVAVGHPPPTNFILVTMGSTAVVLIGWRALFFTIFPSDKGKKND VYRRGSPFELFELLTSLVRRW* | |||
Physicochemical properties | |||
| Number of amino acids: | 261 | ||
| Molecular weight: | 15,925.617 | ||
| Theoretical pI: | 10.699 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
| Instability index: | 31.594 | ||
| aromaticity | 0.084 | ||
| GRAVY | -0.334 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.287 | ||
| sheet | 0.238 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329852.1 | 5prime_partial | 143 | 831-400(-) |
Amino Acid sequence : | |||
| TKGYLQRMKIRLKRHHHLLTNDVSNSKSSKGLPRLYTSFFLPLSEGKMVKNKALQPISTTAVLPIVTNMKLVGGGWPTATALMINPNGIPKDQDFAAAITAFWRPFFPRPSLLYPPRKYA LKNHPAMKGSAVLKVSKSKTENP* | |||
Physicochemical properties | |||
| Number of amino acids: | 143 | ||
| Molecular weight: | 15,925.617 | ||
| Theoretical pI: | 10.699 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
| Instability index: | 31.594 | ||
| aromaticity | 0.084 | ||
| GRAVY | -0.334 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.287 | ||
| sheet | 0.238 | ||