Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY329861.1 | 3prime_partial | 150 | 452-3(-) |
Amino Acid sequence : | |||
MHHSAKGFCGLPPSCRIRHEGEGVEKVKADCDANKLTITGNVVPAALRERVEYKTKKKVELVSPQPKKDAGGDKKADEKSEKKPEEKKADDKKPKEPTVSTVMMKVRLHCDGCAHKIKRV ISKHIDGVDSVKTDLTKDLVTVTGTMNVKE | |||
Physicochemical properties | |||
Number of amino acids: | 150 | ||
Molecular weight: | 13,061.112 | ||
Theoretical pI: | 9.239 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
Instability index: | 32.438 | ||
aromaticity | 0.077 | ||
GRAVY | 0.273 | ||
Secondary Structure Fraction | |||
Helix | 0.410 | ||
turn | 0.248 | ||
sheet | 0.162 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY329861.1 | complete | 132 | 503-901(+) |
Amino Acid sequence : | |||
MKELREITANHPWNIMTTSADEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVAHKIDFTEGPALPVLDQMVADGKYEGSFDFIFVDAD EDNYLNYHKRFD* | |||
Physicochemical properties | |||
Number of amino acids: | 132 | ||
Molecular weight: | 13,061.112 | ||
Theoretical pI: | 9.239 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
Instability index: | 32.438 | ||
aromaticity | 0.077 | ||
GRAVY | 0.273 | ||
Secondary Structure Fraction | |||
Helix | 0.410 | ||
turn | 0.248 | ||
sheet | 0.162 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY329861.1 | 5prime_partial | 117 | 910-557(-) |
Amino Acid sequence : | |||
LTSSIKPLVVVQVVVFVSIHKYKVKGSLVLPICNHLIKNRQSRAFCEVNFVGNASFLNYRQTQFIILPVDVHSQYLSIVGECKSSSQERVAGVNSNLHGVFGIDQLQKHVQELPLIC* | |||
Physicochemical properties | |||
Number of amino acids: | 117 | ||
Molecular weight: | 13,061.112 | ||
Theoretical pI: | 9.239 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
Instability index: | 32.438 | ||
aromaticity | 0.077 | ||
GRAVY | 0.273 | ||
Secondary Structure Fraction | |||
Helix | 0.410 | ||
turn | 0.248 | ||
sheet | 0.162 |