| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329861.1 | 3prime_partial | 150 | 452-3(-) |
Amino Acid sequence : | |||
| MHHSAKGFCGLPPSCRIRHEGEGVEKVKADCDANKLTITGNVVPAALRERVEYKTKKKVELVSPQPKKDAGGDKKADEKSEKKPEEKKADDKKPKEPTVSTVMMKVRLHCDGCAHKIKRV ISKHIDGVDSVKTDLTKDLVTVTGTMNVKE | |||
Physicochemical properties | |||
| Number of amino acids: | 150 | ||
| Molecular weight: | 13,061.112 | ||
| Theoretical pI: | 9.239 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
| Instability index: | 32.438 | ||
| aromaticity | 0.077 | ||
| GRAVY | 0.273 | ||
Secondary Structure Fraction | |||
| Helix | 0.410 | ||
| turn | 0.248 | ||
| sheet | 0.162 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329861.1 | complete | 132 | 503-901(+) |
Amino Acid sequence : | |||
| MKELREITANHPWNIMTTSADEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVAHKIDFTEGPALPVLDQMVADGKYEGSFDFIFVDAD EDNYLNYHKRFD* | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 13,061.112 | ||
| Theoretical pI: | 9.239 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
| Instability index: | 32.438 | ||
| aromaticity | 0.077 | ||
| GRAVY | 0.273 | ||
Secondary Structure Fraction | |||
| Helix | 0.410 | ||
| turn | 0.248 | ||
| sheet | 0.162 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329861.1 | 5prime_partial | 117 | 910-557(-) |
Amino Acid sequence : | |||
| LTSSIKPLVVVQVVVFVSIHKYKVKGSLVLPICNHLIKNRQSRAFCEVNFVGNASFLNYRQTQFIILPVDVHSQYLSIVGECKSSSQERVAGVNSNLHGVFGIDQLQKHVQELPLIC* | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 13,061.112 | ||
| Theoretical pI: | 9.239 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
| Instability index: | 32.438 | ||
| aromaticity | 0.077 | ||
| GRAVY | 0.273 | ||
Secondary Structure Fraction | |||
| Helix | 0.410 | ||
| turn | 0.248 | ||
| sheet | 0.162 | ||