Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY329876.1 | 5prime_partial | 193 | 2-583(+) |
Amino Acid sequence : | |||
SAPAQDETCENKPSKMVTYRFHQYQVVGRALPTETEEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAV EQMYTEMASRHRVRYHCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPTRKLKTTYKATRPNLFM* | |||
Physicochemical properties | |||
Number of amino acids: | 193 | ||
Molecular weight: | 17,183.943 | ||
Theoretical pI: | 6.205 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
Instability index: | 38.088 | ||
aromaticity | 0.025 | ||
GRAVY | 0.518 | ||
Secondary Structure Fraction | |||
Helix | 0.413 | ||
turn | 0.213 | ||
sheet | 0.313 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY329876.1 | 3prime_partial | 160 | 481-2(-) |
Amino Acid sequence : | |||
MELLGALPLAKLGWDSGSLDDLDAVIADPVTRSHLRVHLLDSTVQGGVTVLFVHVVVTSPTLVSQPDSVILDCGRVLLKNLIDSKNLTIALLHLLQLSQKVPELGLGADLVGRPELHAVD LWVLLRLCRQGSADHLVLVESVSHHFRRLVLAGLVLGGGR | |||
Physicochemical properties | |||
Number of amino acids: | 160 | ||
Molecular weight: | 17,183.943 | ||
Theoretical pI: | 6.205 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
Instability index: | 38.088 | ||
aromaticity | 0.025 | ||
GRAVY | 0.518 | ||
Secondary Structure Fraction | |||
Helix | 0.413 | ||
turn | 0.213 | ||
sheet | 0.313 |